Home
›
Products
›
Molecular Biology
›
Sumo Protease
›
Recombinant SUMO Protease Ulp1p (EXRP130-ACF)
Recombinant SUMO Protease Ulp1p (EXRP130-ACF)
$90.00 – $2,600.00Price range: $90.00 through $2,600.00
Category: Sumo Protease
SKU: EXRP130-ACF
In-stock products will arrive in 1 to 2 business days.
For Research Use Only.
Not Intended for Diagnostic or Therapeutic Use.
Key Features
✓ Endotoxin Level: <0.0005 EU/1 Unit
✓ Purity: >98% SDS-PAGE
✓ Biological/Enzymatic Activity: >1×10^5 Units/mg.
✓ Expression System: E. coli using an animal component-free system
Need Help Ordering?
Product Details
Storage & Preparation
Data Images
Background
Product Documents
Product Details
| Biological Activity | SUMO protease Ulp1p is highly specific for cleaving SUMO protein fusions. It exhibits both high activity and specificity, making it a preferred choice for cleaving SUMO tags independently of the target protein’s structure, leaving no additional amino acids at the N-terminus of the target protein. Specific activity is > 1×10^5 Units/mg. One unit of SUMO Protease Ulp1p is the amount of enzyme required to cleave >90% of 20 µg of SUMO-tag fused protein at 30°C in one hour. |
| Purity | >98% by SDS-PAGE and quantitative densitometry by Coomassie® Blue staining. |
| Endotoxin | <0.0005 EU per unit of the protein as determined by the LAL method. |
| Expression System | E. coli using an animal component-free system |
| Accession Number | Q02724 |
| Sequence | Leu403-Lys621, with an N-terminal His-tag and a TEV cleavage site
Met_His6_TEV_LVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKY IEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYV DSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLD FDYKDAIRMRRFIAHLILTDALK |
| Molecular Weight | 28 kDa (monomer, predicted) |
| Formulation | In 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1 mM DTT, 50% Glycerol |
Storage & Preparation
| Shipping | Shipped on blue ice. Store immediately at -20°C upon receipt. |
| Stability & Storage |
|
Data Images
![]() |
![]() |
![]() |
| Recombinant SUMO Protease Ulp1p (2 µg/lane) on SDS-PAGE under reducing (R) conditions. The gel was stained using Coomassie® Blue showing a band at 28 kDa and purity greater than 98%. | SDS-PAGE analysis of Ulp1p cleavage reaction with 20 ug of substrate at 30°C for 60 min with varying enzyme units. Greater than 90% cleavage observed with 1U. | SDS-PAGE analysis of 1U Ulp1p cleavage reaction with 20 ug of substrate at 30°C with varying incubation time. Greater than 90% cleavage observed at 60 min. |
Background
| Alternative Names | SUMO Protease, ULP1, Ubl-specific protease 1 |
| Function | SUMO protease Ulp1p is highly specific for cleaving SUMO protein fusions. It exhibits both high activity and specificity, making it a preferred choice for cleaving SUMO tags independently of the target protein’s structure, leaving no additional amino acids at the N-terminus of the target protein. |
| Cellular Localization | Nucleus |
| UniProt | P06804 |
| Gene Symbol | ULP1 |
| Entrez Gene ID | 856087 |
Product Documents
| Product Datasheet | Download Product Datasheet |
| COA | Contact Us |
| SDS | Download SDS |
You may also be interested in related products:
Reviews (no reviews yet)
Only logged in customers who have purchased this product may leave a review.












Reviews
There are no reviews yet.